SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A220T1Z9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A220T1Z9
Domain Number 1 Region: 62-118
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 3.92e-29
Family Arterivirus nucleocapsid protein 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A220T1Z9
Sequence length 123
Comment (tr|A0A220T1Z9|A0A220T1Z9_PRRSV) N {ECO:0000313|EMBL:ASK40173.1} OX=28344 OS=Porcine reproductive and respiratory syndrome virus (PRRSV). GN= OC=Nidovirales; Arteriviridae; unclassified Arteriviridae. OH=9823
Sequence
MPNNNGKQQKKKKGDGQPVNQLCQMLGKIIAQQNQSRAKGPGRKNKKKNPEKPHFPLATE
DDVRHHFTPGERQLCLSSVHTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTAS
PSA
Download sequence
Identical sequences A0A220T1Z9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]