SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A221TB27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A221TB27
Domain Number 1 Region: 4-92
Classification Level Classification E-value
Superfamily YccV-like 2.09e-27
Family YccV-like 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A221TB27
Sequence length 102
Comment (tr|A0A221TB27|A0A221TB27_PECCA) Heat shock protein HspQ {ECO:0000256|HAMAP-Rule:MF_01194, ECO:0000256|SAAS:SAAS00634478} OX=554 OS=Pectobacterium carotovorum (Erwinia carotovora). GN=SCC1_2749 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MIICKFGIGQQIRHRQLGFPGVVIDIDPEYSLDTPTWEEISGNDTPRAEPWYHVVMEDDE
GQPIHTYLAEAQLMKEELSEHEHPSLNELAEVIQRRAPQLRH
Download sequence
Identical sequences A0A221TB27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]