SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A223ZTW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A223ZTW2
Domain Number - Region: 57-203
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.034
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A223ZTW2
Sequence length 438
Comment (tr|A0A223ZTW2|A0A223ZTW2_STROR) McrBC 5-methylcytosine restriction system component {ECO:0000313|EMBL:BBA08457.1} KW=Complete proteome OX=1077464 OS=Streptococcus oralis subsp. tigurinus. GN=STO1_008530 OC=Streptococcus.
Sequence
MRITDNQHRIAREDFVAEFPNLSQALLDRTLDNLSQEDNIFIFPNDLMNSPDLDKDQKIL
ETVNQEIKTGNVIGFLGCGQERLTISSRFSDESNDHFLHYLLQKVLNINLNSLDVGLSQE
DRLYQLLIYLFPKYLQAALRKGLYKEYQRFSHNDSHVKGVIDVGNHLKRNVPFMGNIAYT
TREFTYDNSLMQLIRHTIEYIKNQKIIGQGLLDNLLTSRENVAEIVRVTPYYKLADRAKI
IRGNQSKPIRHAYFHEYRKLQELCLMILNREKHGLGYQEQKIHGILFDVSWLWEEYVYTL
LPKVFIHPRNKDKTDGISVFSDRERKVFPDFYHKELKIVLDAKYKELEFTEKGINREDLF
QLISYSYILKVEKAGLVFPSKQKVVDNEIGKLAGYGALLKKLSIQIPQKASSYNEFCEMM
ESSEETFKRNITKEVGRN
Download sequence
Identical sequences A0A223ZTW2 X8KBU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]