SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A226EX85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226EX85
Domain Number 1 Region: 10-287
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.71e-105
Family Capz alpha-1 subunit 0.0000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A226EX85
Sequence length 292
Comment (tr|A0A226EX85|A0A226EX85_FOLCA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:OXA62275.1} KW=Complete proteome; Reference proteome OX=158441 OS=Folsomia candida (Springtail). GN=Fcan01_03918 OC=Entomobryomorpha; Isotomoidea; Isotomidae; Proisotominae; Folsomia.
Sequence
MSSSELDEPITSEEKVRIVSDFILHSPPGEFNEVFNDVRTLLNNDTLLKEGASSSFAQYN
KDQLTPCRVQGSEQPVVISEHNDLGGGRFYDPKTKQSFKYDHLKKEASDFQSYDLDKKSE
PWRSALETEFGAYVSQHYPHGVYSIFSKSSGGIVTVIVCIEDHQFQPKNFWNGRWRSQWT
VSFDPSAIGEMVEVKGVVKVQVHYYEDGNVQLVSSKDIKQTIQVANESEFALEFVKLAES
SESEYHNALIENYQTMSDTTFKALRRLLPVTRTKIDWNKIVSYTIGKELRAQ
Download sequence
Identical sequences A0A226EX85
XP_021968541.1.6718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]