SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226MQS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226MQS9
Domain Number 1 Region: 24-89
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.07e-18
Family Interleukin 8-like chemokines 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226MQS9
Sequence length 97
Comment (tr|A0A226MQS9|A0A226MQS9_CALSU) C-C motif chemokine {ECO:0000256|RuleBase:RU361150} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_007032 OC=Odontophoridae; Callipepla.
Sequence
MDKAAGAFCILLLLTVLCSQSLAQRAPAVPDKCCFNFHTRKIKMNNIVACYATSPQCQHQ
AVIFRVKNGKEICTPAEKMWVKRYQQRFQVSSYSIPS
Download sequence
Identical sequences A0A226MQS9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]