SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226N670 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226N670
Domain Number 1 Region: 47-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-17
Family Cell cycle transcription factor e2f-dp 0.00079
Further Details:      
 
Domain Number 2 Region: 124-170
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 0.000000000251
Family E2F dimerization segment 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226N670
Sequence length 179
Comment (tr|A0A226N670|A0A226N670_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB63074.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_016796 OC=Odontophoridae; Callipepla.
Sequence
MAAASKWERLKPLRPDALRLSATPMLNLNLDDDIPVVKKSLKGRRPRFDASLVYLTRKFM
DLVRSAPDGVLDLNDVATALGVQKRRIYDITSVLDGIELIRKRSKNHIQWIGSNLDQVVG
LAAQQQNLRDELSDLSAMEEALDELIKDCAHQLFHLTDDKENAKYPFNSCITLARGFSC
Download sequence
Identical sequences A0A226N670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]