SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A226NDK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226NDK0
Domain Number 1 Region: 131-188
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.25e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000607
Further Details:      
 
Domain Number 2 Region: 7-44
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000863
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226NDK0
Sequence length 188
Comment (tr|A0A226NDK0|A0A226NDK0_CALSU) Uncharacterized protein {ECO:0000313|EMBL:OXB65628.1} KW=Complete proteome; Reference proteome OX=9009 OS=Callipepla squamata (Scaled quail). GN=ASZ78_011513 OC=Odontophoridae; Callipepla.
Sequence
MASSTNTNPVPKLYRSVIEDVINDVREVFLDEGVDEQVLMELKTGEVMQCENWSAAATAA
TLALPAGVTPVQQILTNSGQILQVVRTANGAQYIIQPQQPVVLQQQVIPQMQPGGVQAPV
IQQEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYVFS
KAIGDAEW
Download sequence
Identical sequences A0A226NDK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]