SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A226PE26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A226PE26
Domain Number 1 Region: 8-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.37e-105
Family Capz alpha-1 subunit 0.00000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A226PE26
Sequence length 265
Comment (tr|A0A226PE26|A0A226PE26_COLVI) Uncharacterized protein {ECO:0000313|EMBL:OXB78295.1} KW=Complete proteome; Reference proteome OX=9014 OS=Colinus virginianus (Northern bobwhite) (Tetrao virginianus). GN=H355_013914 OC=Odontophoridae; Colinus.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIDGYDEQVLITEHGDLGNGKFLDPKNKISFKFDHLRKEATDPRPHEVENAIESW
RNSVETAMKAYVKEHYPNGVCTVYGKTIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
ISPSTTQVAGILKIQVHYYEDGNVQLVSHKDIQDSLTVSTAISENYQTMSDTTFKALRRQ
LPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A226PE26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]