SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A228PYT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A228PYT8
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 4.88e-33
Family Frataxin-like 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A228PYT8
Sequence length 109
Comment (tr|A0A228PYT8|A0A228PYT8_9BURK) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome OX=2015344 OS=Burkholderia sp. AU6039. GN=CFB39_01775 OC=Burkholderiaceae; Burkholderia.
Sequence
MSDTEYLTRAEAVLAAVERTVDDANDGDHDIDLERNGSVLTLTFENGSKIIVNLQPPMKE
VWIAARAGGFHYRFIDGEWRDTRTGTEFFSALTEYATQQAGLPITFSAP
Download sequence
Identical sequences A0A228HAY1 A0A228K5S5 A0A228PYT8 A0A228RK38
WP_069246934.1.21687 WP_069246934.1.2894 WP_069246934.1.33258 WP_069246934.1.35537 WP_069246934.1.36191 WP_069246934.1.36737 WP_069246934.1.66449 WP_069246934.1.84218 WP_069246934.1.90044 WP_069246934.1.99173 WP_069246934.1.99354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]