SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A229XVK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A229XVK7
Domain Number 1 Region: 180-248
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000196
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A229XVK7
Sequence length 256
Comment (tr|A0A229XVK7|A0A229XVK7_ASPFM) Uncharacterized protein {ECO:0000313|EMBL:OXN24208.1} KW=Complete proteome OX=746128 OS=Neosartorya fumigata (Aspergillus fumigatus). GN=CDV57_07280 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MDPALNSDTPPPPPPRPSSHETSRRGTPQLNQSIPGTPQHQFRGYHQAQEGENGENRYQS
PLMAAEAFHANNINSLPKPPTVEEGWLPDVVKDKSTVDLQAILRDPNLISALASQHPACT
AQQENLQSLLKYNQDLTKHLLELQARLDEQRASTETLLLKHQSLEVSWRKKQSEMDAALA
PWSPKALYQRLSASISEQEAVCRAVEESFLEKEHHGRATEKEVADWVRRVRAEAAKLAAR
REAKARWDEGRVGGWR
Download sequence
Identical sequences A0A0J5PZS5 A0A229XVK7 B0XQ94 Q4WTD1
5085.CADAFUAP00007445 XP_752339.1.65241 Afum_A1163:AFUB_009170.t1 Afu1g09720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]