SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A232EKJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A232EKJ9
Domain Number 1 Region: 232-297
Classification Level Classification E-value
Superfamily XPC-binding domain 1.96e-23
Family XPC-binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.45e-22
Family Ubiquitin-related 0.00019
Further Details:      
 
Domain Number 3 Region: 147-209
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000316
Family UBA domain 0.0014
Further Details:      
 
Domain Number 4 Region: 318-376
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000175
Family UBA domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A232EKJ9
Sequence length 377
Comment (tr|A0A232EKJ9|A0A232EKJ9_9HYME) Uncharacterized protein {ECO:0000313|EMBL:OXU18873.1} KW=Complete proteome; Reference proteome OX=543379 OS=Trichomalopsis sarcophagae. GN=TSAR_013780 OC=Chalcidoidea; Pteromalidae; Pteromalinae; Trichomalopsis.
Sequence
MIITIKNLWQQTFTVEIDATKTVKDLKDKIEAQKGFPSQHQKLIYAGKILTDEQPLTEYN
IDEKKFVVVMVSKPKNEASTSDETQSGTDSTKSKEQTAPTSTPAPAPAPVQTSVPAPVTE
AASVQAPSSVPAPTTAPTRTPETATQQPTPTSVATSNPPESALLMGEEYNAMVNNIMDMG
YERDQVEQALRASFNNPDRAVEYLLTGIPAQLFEDPPEEAAESQDALPADAGQDPLAFLR
TQPQFQQMRQVIQQNPQLLNPVLQQIGQTNPALLQLISQNQEAFVRMLNEPVGATSGGST
PASAISAIPPVAPGGLGAGTGVPGGPGVIQISPQDKEAIERLKSLGFPEDLVVQAYFACE
KNENLAANFLLSQNLDD
Download sequence
Identical sequences A0A232EKJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]