SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A232F430 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A232F430
Domain Number 1 Region: 152-248
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.44e-25
Family ERP29 C domain-like 0.00082
Further Details:      
 
Domain Number 2 Region: 30-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000389
Family ERP29 N domain-like 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A232F430
Sequence length 252
Comment (tr|A0A232F430|A0A232F430_9HYME) Uncharacterized protein {ECO:0000313|EMBL:OXU25289.1} KW=Complete proteome; Reference proteome OX=543379 OS=Trichomalopsis sarcophagae. GN=TSAR_017024 OC=Chalcidoidea; Pteromalidae; Pteromalinae; Trichomalopsis.
Sequence
MMRRVFLTIISALVAFCTEMEFSAADDCRACVQLNFFSFDKVIPKFKAAVVKFDVAFPYG
EKHEEFSKVAMSSRDSMDLLVAEVGVKDFGNKDNSELAQRYGVSKDDYPVVLLFIQGKTE
PYKFVAETDADFTADNIKRFVKKKSGVYLGLPGCVEKLDRLAEEFRTSSEKDRQEILNKA
KVFEDTLPEEHRPAAKVYVKTMERIMERGDVFVQTEHTRIEGLLKGKLSSDKKRTMEERR
NILQSFTHRDEL
Download sequence
Identical sequences A0A232F430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]