SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A235AMW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A235AMW1
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily BB2672-like 3.01e-69
Family BB2672-like 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A235AMW1
Sequence length 200
Comment (tr|A0A235AMW1|A0A235AMW1_9RHIZ) Amino acid synthesis family protein {ECO:0000313|EMBL:OYD01334.1} KW=Complete proteome OX=1703972 OS=Rhizobium sp. N4311. GN=AMK08_PA00028 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MAIQIRKTGLQIETTLIEGGKAAAVPLKLFTAFAVVKNPWAGRGFVEDLKPEIHAGAPVL
GELLTKMIIDAVGSGDAVEGYGKAAVVGLDGEIEHASALIHTLRFGNFYRHAVGAKSYLA
FCNTRGPANAPIMIPLMDKNDEGRRSHYLTIQTSIPDAPAADEIVVALGASVGGRPHHRI
GDRYQDLKDLGQDVANPAGV
Download sequence
Identical sequences A0A235AMW1
WP_064841512.1.10236 WP_064841512.1.17708 WP_064841512.1.28224 WP_064841512.1.61011 WP_064841512.1.68417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]