SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A238FNL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A238FNL6
Domain Number 1 Region: 64-252
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-17
Family Capz beta-1 subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 655-747
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000093
Family UBX domain 0.028
Further Details:      
 
Domain Number 3 Region: 431-519
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000011
Family UAS domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A238FNL6
Sequence length 776
Comment (tr|A0A238FNL6|A0A238FNL6_9BASI) BQ2448_4335 protein {ECO:0000313|EMBL:SCV72798.1} KW=Complete proteome; Reference proteome OX=269621 OS=Microbotryum intermedium. GN=BQ2448_4335 OC=Microbotryomycetes; Microbotryales; Microbotryaceae; Microbotryum.
Sequence
MSRSDMAPWHTAHDPDPELTLYAPFDPSLPPPPTAPDEQQHPAPEHDLVSLATDLPGLAS
SSGMLGPLQFNLDTLQDDQGKAFITSKFNQQGTSSPWTNKYTLPTTASSSTVLSGRVRAL
EVALNQAVSELRDRLWPGGVSSVYLREADAAQSTHGVALVRKVHEFSISHLPHAPSAWYT
LDSTIEVHKDRVGGSTSNSSRSELPVEGPSTSAQHSSHAKNVVQLIEQQERQLRETLQQF
HRSAHRDTICGLVTQPQSTTVDGGFLRHAYPPATNDVEDDYGDSESQHLLDEFGIDETMP
STSDRAPAQYGPFTMWLRRFLQLPLRILAIPIGLLGIVFGIVARLLRIRPGQTSLRPRNP
FARDARSLQRMDPVGSAERFVRSIEEMTGAVRWSRRLGDAQGSSSSVVGTSSGLSSLERR
RSGSNSSARKALPDFWIGSYESALKKANDDFQVLMVVLTCDEHEDDELFKRRVLTDTELL
NALAREKILVWGGDVRDVDAYQASKALQFFRLPFVAFIALQPRSSTPTLPGSASISSPKL
SVVTRLEGSPNSTLSASSLLAHLTNVVLPRVNPFMARLKAQHATRLEERRLRQEQDRAFA
ISAQRDEERVLRKRAEESQRQRDVEVRKRKEEKALRIREGSKKWRAWKRGQLQAEGEREG
VRIGVRLGDGRRVVRSFAKDAKVEDVYAYVECSLETDDGERREAPPDDYEHVYEFQLAAP
FPRNVLEIDGDAGQRALEQIPWLDKNVSLIVEGLEQRRISLGESGASDDEMDEDED
Download sequence
Identical sequences A0A238FNL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]