SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A241ZIZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A241ZIZ8
Domain Number - Region: 139-173
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0562
Family Preprotein translocase SecE subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A241ZIZ8
Sequence length 188
Comment (tr|A0A241ZIZ8|A0A241ZIZ8_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:OTM93010.1} KW=Complete proteome OX=470 OS=Acinetobacter baumannii. GN=B9X95_02930 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MNEEKDPEIKYLSNDEDLFHVEKKIYLPTFIFQEFFVFLCITFGSYFSIFISSQKFATEE
SFSKSFNLVFAFFTIENLIDTSIGLFIVMGILCFVNHLTTHSKLNIQPILNRLISAVTDF
YYLMFSTILGCMLGLFHFLHKFPMIKEYEQLHQLAISGMITIGLVGSTTSIAIQFFVHKN
KVLHKKPD
Download sequence
Identical sequences A0A241ZIZ8 R9BF24
WP_016165575.1.16343 WP_016165575.1.41661 WP_016165575.1.64985 WP_016165575.1.79607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]