SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A242C426 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A242C426
Domain Number - Region: 9-48
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A242C426
Sequence length 238
Comment (tr|A0A242C426|A0A242C426_9ENTE) Uncharacterized protein {ECO:0000313|EMBL:OTO05004.1} KW=Complete proteome OX=1834182 OS=Enterococcus sp. 5B3_DIV0040. GN=A5883_001994 OC=Enterococcus.
Sequence
MERSKIDPGRFFSGQKAATKGTLKHQYHYYRQQNAHQAFNSDFQRNFQHDFPNFATWLKL
QQQTPQKNQTATFSHWLLVGFFGLLTAASFSQQLLFLLFVFVLAALVKGPGMIVWGIVYS
FLVSLFPPLGIVLSGLFFLLTLRQLTKNVTFVLTALYFYGYPFVITALQHFTNWDPQWLW
VGSIGFALISGHFVLKQNYPFASSKSLAWAIISVPYDCVMALIPVKHKARFKRLVKIK
Download sequence
Identical sequences A0A1G8X2H8 A0A242C426 A0A242D1Y3 C9A6M1
gi|478484688|ref|YP_007752269.1| WP_015509323.1.100891 WP_015509323.1.34310 WP_015509323.1.66137 WP_015509323.1.8541 WP_015509323.1.99503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]