SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A242ZE30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A242ZE30
Domain Number - Region: 27-135
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0107
Family Capz beta-1 subunit 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A242ZE30
Sequence length 146
Comment (tr|A0A242ZE30|A0A242ZE30_BACTU) Uncharacterized protein {ECO:0000313|EMBL:OTX91443.1} KW=Complete proteome OX=180846 OS=Bacillus thuringiensis serovar londrina. GN=BK726_10900 OC=Bacillus cereus group.
Sequence
MNTINKILSDFAAINADEYVSNYYGLSIMSENKKDNIFELAKKATHATSNDTLELIQLKE
WKKEFLICQYTNGESYWFGKIPHGYDLNGSTSKEYVIEKLLNVFKQEPEEVYWINLDPGG
YYACCYEEYLFKTNKGIYFFNMQVHD
Download sequence
Identical sequences A0A242ZE30 C2P8F4
WP_001092358.1.26483 WP_001092358.1.97082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]