SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A249QGW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A249QGW7
Domain Number 1 Region: 1-209
Classification Level Classification E-value
Superfamily YcfC-like 4.58e-83
Family YcfC-like 0.0000000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A249QGW7
Sequence length 212
Comment (tr|A0A249QGW7|A0A249QGW7_9GAMM) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695} KW=Complete proteome OX=2042057 OS=Pectobacterium polaris. GN=BJJ97_14590 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MAKNYYEITLALAGICQSAYVVQQLAHTGSCNNDVLHTALNSVLNLNPASTLAVYGNDEQ
NLKVGLETLLGILNTSSNKGAGAELSRYAFSLIALERKLNAKSAALDELGKRIGQLERQL
EHFELLSETIVSALAAIYVDVISTLGPRIQVTGSPEVLKNSQVQAKVRAALLAGIRSAVL
WQQIGGGRLQLMFSRGKLVKEAKQILARCPAD
Download sequence
Identical sequences A0A249QGW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]