SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A254Q7B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A254Q7B4
Domain Number 1 Region: 7-119
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.6e-27
Family Frataxin-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A254Q7B4
Sequence length 127
Comment (tr|A0A254Q7B4|A0A254Q7B4_9BURK) Iron-sulfur cluster assembly protein CyaY {ECO:0000256|HAMAP-Rule:MF_00142, ECO:0000256|SAAS:SAAS01015787} KW=Complete proteome; Reference proteome OX=1743164 OS=Polynucleobacter aenigmaticus. GN=CBI30_02335 OC=Burkholderiaceae; Polynucleobacter.
Sequence
MKPNNLAVASIDDKQFHQLGSNLMESIEVALEAADDALDLDLDVERQGGNVINIRFKDRS
IIVVNTQAPLHEIWVAAKSGGYHYRWAGTLTAPLWLDTKTGQELLSDLSAFASAQAGQAV
TISLIQK
Download sequence
Identical sequences A0A254Q7B4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]