SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A254TPP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A254TPP1
Domain Number 1 Region: 21-129
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000602
Family Apolipoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A254TPP1
Sequence length 142
Comment (tr|A0A254TPP1|A0A254TPP1_ASPNG) Uncharacterized protein {ECO:0000313|EMBL:OWW28978.1} KW=Complete proteome OX=5061 OS=Aspergillus niger. GN=CAN33_49545 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MIEQRLKRYVDEMIERRLKSGVLDEVVDSAVSECRDQIYDECKTNQAEFREQVDDGNSEI
RNTTIECMKEMNEQAQRHMHEIEEQAQQCMRDIEDQGFEVEMSAKKNMAKLKRWCDTPAR
SLPETTVNLSHEIDTTARRSSI
Download sequence
Identical sequences A0A254TPP1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]