SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A254TRM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A254TRM6
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.71e-40
Family Calponin-homology domain, CH-domain 0.0000245
Further Details:      
 
Domain Number 2 Region: 152-220
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.57e-16
Family EB1 dimerisation domain-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A254TRM6
Sequence length 234
Comment (tr|A0A254TRM6|A0A254TRM6_ASPNG) EB1-like C-terminal motif family protein {ECO:0000313|EMBL:OWW29658.1} KW=Complete proteome OX=5061 OS=Aspergillus niger. GN=CAN33_52935 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MSESRQELLAWINNLLQLNMTKVEQCGTGAALCQIFDSIFMDVPMSRVKFNVNTEYAYLQ
NFKVLQNVFAKHQVDKPIPVESLTKCRMQDNLEFLQWTKKYWDQHYPGGDYDAVARRKAS
GASSAGAARRGTTPTIGAARPRVAGAASAANVSALQQEIATQKEAIAGLEKERDFYFAKL
RDIELLLQSAIEADPELEKDDDSLVKHIQGILYSTEEGFEIPEAEAGADELETF
Download sequence
Identical sequences A0A254TRM6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]