SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A256YH56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A256YH56
Domain Number 1 Region: 4-52
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.00000000000144
Family Preprotein translocase SecE subunit 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A256YH56
Sequence length 62
Comment (tr|A0A256YH56|A0A256YH56_9CREN) Protein transport protein Sec61 gamma subunit homolog {ECO:0000256|HAMAP-Rule:MF_00422} KW=Complete proteome; Reference proteome OX=2012521 OS=Desulfurococcales archaeon ex4484_58. GN=B6U89_03560 OC=Archaea; Crenarchaeota; Thermoprotei; Desulfurococcales.
Sequence
MGFRELIDAWRKIIRLATKPSHEDYLTSLKMSLLGLTLVGAIAFIIRFILIVFVFPQQLY
GG
Download sequence
Identical sequences A0A256YH56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]