SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A260YSA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A260YSA7
Domain Number 1 Region: 21-127
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.45e-31
Family Frataxin-like 0.0000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A260YSA7
Sequence length 136
Comment (tr|A0A260YSA7|A0A260YSA7_CAERE) Uncharacterized protein {ECO:0000313|EMBL:OZF76268.1} KW=Complete proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=FL82_12062 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MLSSILRNPLVRRTFSARVVSQNEYETAADSTLEKLSDYFDQIADSYPVSDQFDVSHAMG
VLTVNVSKSVGTYVINKQSPNKQIWLSSPMSGPKRYDLAEEDRWTYSHDGEKLDELLNRE
FRKILGDDRIDFSRHV
Download sequence
Identical sequences A0A260YSA7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]