SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A261BBT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A261BBT1
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000118
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 78-135
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000432
Family Skp1 dimerisation domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A261BBT1
Sequence length 163
Comment (tr|A0A261BBT1|A0A261BBT1_CAERE) Uncharacterized protein {ECO:0000313|EMBL:OZG07802.1} KW=Complete proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=FL82_02106 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MVVGQRKPIFKIRSSDGQIFVIQDWLIQKSKSFSVVYPFMKDSAQPLQTTVSSFILEKII
EWCHHHRHDDADQDYRLIPIWDAQFLNDNNGIVFLLIEAAYRLEIRGLLDIACRAVSITL
GRSMNEVKVMLRVGEPEDVFNVDDELREDDEEDADMIPAIPAA
Download sequence
Identical sequences A0A261BBT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]