SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A261XXG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A261XXG2
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.5e-82
Family Capz beta-1 subunit 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A261XXG2
Sequence length 258
Comment (tr|A0A261XXG2|A0A261XXG2_9FUNG) F-actin-capping protein subunit beta isoforms 1 and 2 {ECO:0000313|EMBL:OZJ03059.1} OX=1938954 OS=Bifiguratus adelaidae. GN=BZG36_03778 OC=Endogonales incertae sedis; Bifiguratus.
Sequence
MRRLPPQNTEENLAKLIDLVPHLADDLLSTVDQPLKVRRCKQTGKDYLVCDYNRDGDAYR
SPWSNEYDPALADGAQPSEKLRLLEVTANEAFDTYREMYFEGGISSVYLWDLDDGFAGVV
LIKKVGDGVRRMKGAWDSIHVFEAQERGRMGHYKLTSTVLLYMITNKQDLGNMNLSGSMT
RQAEQEMPLDGPSAHIANIGRMVEDMEMKMRNLLQEVYFGKTKDIVNDLRSVGSLRESER
NAHIQRELVGKLMERGSR
Download sequence
Identical sequences A0A261XXG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]