SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A264C406 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A264C406
Domain Number - Region: 84-118
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0262
Family Capz alpha-1 subunit 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A264C406
Sequence length 141
Comment (tr|A0A264C406|A0A264C406_KLEVA) Uncharacterized protein {ECO:0000313|EMBL:OZQ45518.1} KW=Complete proteome OX=244366 OS=Klebsiella variicola. GN=CIG61_12455 OC=Enterobacteriaceae; Klebsiella.
Sequence
MIDNRTVSAIDLALQKHPTPVGDLFAAIRHGRMKRCFSRDTAIRYLAFFMTSRAFGRSGF
KQRYPDVQVIHPLNPELSSWQRGAVTTEYFNAHQRTVRRLRRILARKREMQNWCKKWDAM
HDRYVKEREELQACKPGGLSR
Download sequence
Identical sequences A0A1Y6GKN0 A0A264C406 A0A2I8T2H8
WP_032439899.1.10794 WP_032439899.1.25918 WP_032439899.1.2686 WP_032439899.1.32915 WP_032439899.1.39456 WP_032439899.1.40054 WP_032439899.1.40817 WP_032439899.1.49209 WP_032439899.1.49579 WP_032439899.1.5031 WP_032439899.1.5121 WP_032439899.1.51743 WP_032439899.1.61898 WP_032439899.1.62090 WP_032439899.1.63404 WP_032439899.1.67858 WP_032439899.1.6823 WP_032439899.1.75398 WP_032439899.1.75439 WP_032439899.1.80564 WP_032439899.1.84553 WP_032439899.1.87313 WP_032439899.1.96289 WP_032439899.1.96737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]