SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A264C4L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A264C4L5
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily YcfC-like 7.06e-82
Family YcfC-like 0.00000000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A264C4L5
Sequence length 213
Comment (tr|A0A264C4L5|A0A264C4L5_KLEVA) High frequency lysogenization protein HflD homolog {ECO:0000256|HAMAP-Rule:MF_00695} KW=Complete proteome OX=244366 OS=Klebsiella variicola. GN=CIG61_13785 OC=Enterobacteriaceae; Klebsiella.
Sequence
MAKNYYDITLALAGVCQAARLVQQLAHQGHCDSDALHVSLNSIIDLDPESTLAVFGGSEA
NLRLGLETLLGVLNTSSRQGLNAELTRYTLSLMVLERKLAASKGAMDTLGNRIAGLHRQL
EHFDLQSETLLSAMAGIYVDVISPLGPRIQVTGSPAVLQSLQVQAKVRSALLAGIRAAVL
WHQVGGGRLQLMFSRNRLVNQAKQILAHLTPEL
Download sequence
Identical sequences A0A264C4L5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]