SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A267G271 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A267G271
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.19e-16
Family Transducin (heterotrimeric G protein), gamma chain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A267G271
Sequence length 66
Comment (tr|A0A267G271|A0A267G271_9PLAT) Uncharacterized protein {ECO:0000313|EMBL:PAA80185.1} KW=Complete proteome OX=282301 OS=Macrostomum lignano. GN=BOX15_Mlig025846g1 OC=Macrostomida; Macrostomidae; Macrostomum.
Sequence
MSSIAQQKKIVEQLRVEAGMARKPVSECVRDMVQFMESNKDKDFIVSGFASKKDNPFQEK
GGCMLL
Download sequence
Identical sequences A0A267G271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]