SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A284RF31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A284RF31
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-78
Family Capz alpha-1 subunit 0.00000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A284RF31
Sequence length 298
Comment (tr|A0A284RF31|A0A284RF31_9AGAR) Related to F-actin-capping protein subunit alpha {ECO:0000313|EMBL:SJL07372.1} KW=Complete proteome; Reference proteome OX=47428 OS=Armillaria ostoyae. GN=ARMOST_10719 OC=Armillaria.
Sequence
MDAKERIDAACSFLLQSPPGEINDVLNDVRNIISDDDSLQEGVLPALREYNLAQFMAVDV
PGTDHQSIVSEAARVDGTERFLDPRSQTSFAFDHLILEASDPRPVDPNEDSEPFRSALEK
ATLQYLSAHFHDGVSSVFSSTSSPNQFVIQVVANKYNPSNYWSGRWRSEYIVDLNEHKVD
GKVLVNVHYYEQGNVQLATTHTVSITLPSTIVTSSPATSTTKILALIESEEGKFQSILND
TYQDMGEKTFKGLRRALPLTRQKMDWDKACSRFLLITHSAYIPTSGSWLQAGRRAILE
Download sequence
Identical sequences A0A284RF31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]