SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286JTU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286JTU9
Domain Number 1 Region: 6-99
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 1.12e-34
Family Glycoprotein B-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286JTU9
Sequence length 99
Comment (tr|A0A286JTU9|A0A286JTU9_HCMV) Glycoprotein B {ECO:0000313|EMBL:AKM12555.1} OX=10359 OS=Human cytomegalovirus (HHV-5) (Human herpesvirus 5). GN=UL55 OC=Betaherpesvirinae; Cytomegalovirus. OH=9606
Sequence
ELERLANRSSLNLTHNRTKRSTDGNNATHLSNMESVHNLVYAQLQFTYDTLRGYINRALA
QIAEAWCVDQRRTLEVFKELSKINPSAILSAIYNKPIAA
Download sequence
Identical sequences A0A286JTU3 A0A286JTU9 A0A286JTV2 A0A286JTV5 A0A286JTV7 A0A286JTW4 A0A286JTW7 A0A286JTW8 A0A286JTX1 A0A286JTX2 A0A286JTX5 A0A286JTX6 A0A286JTX9 A0A286JTY2 A0A286JTY3 A0A286JTY5 A0A286JTY8 A0A286JU01 A0A286JU08 A0A286JU10 A0A286JU11 A0A286JU12 A0A286JU14 Q80QG0
Q80QG0_HCMV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]