SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286XMA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XMA9
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000275
Family Transducin (heterotrimeric G protein), gamma chain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A286XMA9
Sequence length 41
Comment (tr|A0A286XMA9|A0A286XMA9_CAVPO) Uncharacterized protein {ECO:0000313|Ensembl:ENSCPOP00000026547} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=Gng5 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
VSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
Download sequence
Identical sequences A0A087QHL2 A0A091EJ34 A0A091GF74 A0A091HBP6 A0A091IX17 A0A091LJ96 A0A091M5N4 A0A091NGQ7 A0A091S9I6 A0A091VJW5 A0A091WFF5 A0A093F1K8 A0A093FB10 A0A093GJY1 A0A093HF77 A0A093LMD5 A0A093NJS3 A0A093Q3W9 A0A093Q4B0 A0A094KGT1 A0A094KKG1 A0A0A0AFY8 A0A286XMA9 R0LCV5 U3KI92
ENSEEUP00000000623 ENSEEUP00000000986 9685.ENSFCAP00000010632 ENSVPAP00000005464 ENSTBEP00000012057 ENSTSYP00000009157 ENSTBEP00000012057 ENSFALP00000014746 ENSFCAP00000010632 ENSCHOP00000002118 ENSAPLP00000000034 ENSEEUP00000000623 ENSEEUP00000000986 ENSTSYP00000009157 ENSCHOP00000002118 ENSVPAP00000005464 XP_008938551.1.37566 XP_009512186.1.22320 XP_009702715.1.71050 XP_009818680.1.37116 XP_009876588.1.31609 XP_009920234.1.2804 XP_009956903.1.99599 XP_009967898.1.75343 XP_009989014.1.11325 XP_010018519.1.70042 XP_010078119.1.40768 XP_010115677.1.88979 XP_010135871.1.100080 XP_010166576.1.30499 XP_010190468.1.17318 XP_010198868.1.23224 XP_010287186.1.48707 XP_010297443.1.13389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]