SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287AIN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287AIN0
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.87e-17
Family Ubiquitin-related 0.0000371
Further Details:      
 
Domain Number 2 Region: 175-224
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0000000000128
Family XPC-binding domain 0.00017
Further Details:      
 
Domain Number 3 Region: 115-161
Classification Level Classification E-value
Superfamily UBA-like 0.000000000681
Family UBA domain 0.0013
Further Details:      
 
Domain Number 4 Region: 233-275
Classification Level Classification E-value
Superfamily UBA-like 0.0000766
Family UBA domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287AIN0
Sequence length 281
Comment (tr|A0A287AIN0|A0A287AIN0_PIG) Uncharacterized protein {ECO:0000313|Ensembl:ENSSSCP00000043868} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN= OC=Sus.
Sequence
MSITLKTLQQQTFKIDINSEETVKALKETTESEEGEDAFPVADQKLGGKILNDDTALKEY
KIDEKNFVVVMVTKPKGFLHSTNCASTTASSELAPASAMKQEKPEESTSGDSSQSNLFED
AKSALVTGQSYENMVTEIMSMGYEREQVIAALRANFNNPEQTTVTAMTITKSSRGQPLEF
LQNQPQFQQMRQIIQQNPCLLPLLQQIIQHQQHFIQMLSEPVQKAGIAEAESGHKNDIQV
TPQEKEAMERLKALGFPEGLVMQAYFNLAANLILQQNFVED
Download sequence
Identical sequences A0A287AIN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]