SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287PZW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287PZW0
Domain Number 1 Region: 90-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.57e-17
Family Skp1 dimerisation domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 17-80
Classification Level Classification E-value
Superfamily POZ domain 0.000000000753
Family BTB/POZ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287PZW0
Sequence length 244
Comment (tr|A0A287PZW0|A0A287PZW0_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU4Hr1G086820.22} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MSESELSVIKPESLKTYIWLQCFDGSIQQVEEEVAMFCPMICREIVKNGTGSSKNHAIAL
PERVNPSSLSLILDYCRFHQVPGRSNKERKSFDEKFVRIDTEKLCELTSAADSLQLKPLV
DLTSRALARIIEGKTPEEIRDIFHLPDDLTEEEKLEPLKNLNDDPRIRLLNRLYAKKRKE
LQERQKLKDIQVKQEQKDERSLDELLCFINGDGEVLVVGKLVRIRKRTREGRILRTSQRL
TLNM
Download sequence
Identical sequences A0A287PZW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]