SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A290DS01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A290DS01
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 2.3e-52
Family Spike glycoprotein-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A290DS01
Sequence length 190
Comment (tr|A0A290DS01|A0A290DS01_9RHAB) Glycoprotein {ECO:0000313|EMBL:ATB20018.1} OX=11290 OS=Infectious hematopoietic necrosis virus. GN=G OC=Mononegavirales; Rhabdoviridae; Novirhabdovirus.
Sequence
CTKSPCQTHWSNVVWMGDAGIPACDSSQEIKGHLFVDKISNRVVKATSYGHHPWGLHQAC
MIEFCGKPWIRTDLGDLISVEYNSGSEILSFPKCEDKTVGMRGNLDDFAYLDDLVKASES
REECLEAHAEIISTNSVTPYLLSKFRSPHPGINDVYAMHKGSIYHGMCMTVAVDEVSKDR
TTYRAHRATS
Download sequence
Identical sequences A0A290D9T0 A0A290DAN8 A0A290DAZ7 A0A290DS01

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]