SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A290N905 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A290N905
Domain Number 1 Region: 266-362
Classification Level Classification E-value
Superfamily Acid proteases 0.0000962
Family Retroviral protease (retropepsin) 0.055
Further Details:      
 
Weak hits

Sequence:  A0A290N905
Domain Number - Region: 72-194
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0201
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A290N905
Sequence length 381
Comment (tr|A0A290N905|A0A290N905_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:ATC37315.1} KW=Complete proteome OX=1246994 OS=Elizabethkingia anophelis R26. GN=BAZ09_014260 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MKHFFSLSLLFVMVLCFSQRKVTIVKANSNNAKIYEEDNRVSGWGINPKVNPDTHTTGKI
TKRKKVVFKTDIDSIIVNLKPGEKKDFIVLLNGKDSCYTRIQGPEVKNFSREKPEIHDTI
PFIVNKYNTNLVKTFFNHKDSLTFNFDTGATEMSVTRDALKNKIKSNPKLYNTLYDIQIG
RRTYKSEIYDHEMVGQEADGLLGWNIFDGLVVELNYDTEKMIVHSKMPKDIMKDKDYSKF
KIWYFNNKPFIECDMSENGVWYKEWFLFDLGYQRSVMLDNDLLKDKKFPVDNMKIIKKTS
LRGVSGKEIPVITANLQKIKIGKAELKNIPAQLLTANKPMGNAKIHILGNDILKRFNTVL
DFQNDIIYLKPNSLSGKELLN
Download sequence
Identical sequences A0A290N905
WP_009087974.1.20431 WP_009087974.1.23011 WP_009087974.1.33535 WP_009087974.1.44679 WP_009087974.1.68736 WP_009087974.1.77993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]