SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A290Z6Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A290Z6Q5
Domain Number - Region: 29-67
Classification Level Classification E-value
Superfamily Dipeptide transport protein 0.0602
Family Dipeptide transport protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A290Z6Q5
Sequence length 154
Comment (tr|A0A290Z6Q5|A0A290Z6Q5_9PSEU) Uncharacterized protein {ECO:0000313|EMBL:ATE54652.1} KW=Complete proteome OX=42197 OS=Actinosynnema pretiosum. GN=CNX65_16320 OC=Actinosynnema.
Sequence
MTDTTTRHRTPVQNAALAVGAVFLLVGIAGFVPGLTTNYDGLEFAGHHSDAALLGVFKVS
ALHNLVHLAFGAAGIAAGLSKAPRGARAFLIGGGAIYAVLWLYGVVVDEHSTANFVPLNA
ADNWLHLGLAVGMIGLGAALGRNAAHYRAARSDD
Download sequence
Identical sequences A0A290Z6Q5 Q8KUH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]