SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A291EST2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A291EST2
Domain Number 1 Region: 80-147
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 6.41e-30
Family Cyanase C-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.93e-20
Family Cyanase N-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A291EST2
Sequence length 147
Comment (tr|A0A291EST2|A0A291EST2_RALPI) Cyanate lyase {ECO:0000256|HAMAP-Rule:MF_00535} KW=Complete proteome OX=329 OS=Ralstonia pickettii (Burkholderia pickettii). GN=CO705_20830 OC=Burkholderiaceae; Ralstonia.
Sequence
MQREDVTDLIVLQKIKKQLTWAQLAEVIGHSKEWSTAALLGQMTLTEAQANAVGAALDLP
EEAIALLQVPPYKGSLPTAVPTDPLIYRFYELISVYGTTFKALIHEEFGDGIMSAIDFNM
DLTREPDPKGDRVRIVMSGKFLPYKTY
Download sequence
Identical sequences A0A161GUI9 A0A291EST2
WP_063393862.1.79380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]