SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A292IIR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A292IIR0
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000000157
Family Apolipoprotein 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A292IIR0
Sequence length 217
Comment (tr|A0A292IIR0|A0A292IIR0_9MOLU) Uncharacterized protein {ECO:0000313|EMBL:CDN40829.1} OX=572419 OS=Mycoplasma amphoriforme A39. GN=MAMA39_07120 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MKKWTLDKLAELIVSEVDKVNTKIDKNHKEVNDKIDKNHKEVNDRIDQVEKNQKELNAKI
DKNYQELNAKIDKNYQELNAKIDKNHQEVNAKIDKNYQELNTKIDKNHQEVNAKIDKNHK
EVNTRIDRYHLKRKTKYKQADKWMFGKELLLVNIKKMYDQQVFKEIMEDVQTLLSYPKLN
LQGVHFLINNTIFVKASELLEALDASSIRNVALIKVY
Download sequence
Identical sequences A0A292IIR0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]