SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A293M5H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A293M5H4
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.29e-16
Family P-domain of calnexin/calreticulin 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A293M5H4
Sequence length 189
Comment (tr|A0A293M5H4|A0A293M5H4_ORNER) Uncharacterized protein {ECO:0000313|EMBL:MAA36223.1} OX=265619 OS=Ornithodoros erraticus (European soft tick) (Alectorobius erraticus). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Argasidae; Ornithodoros.
Sequence
MDGEWEPPQINNPKSGTIFDNKQIDNPAYKGVWVHPEIDNPEYSPDPHLYKYKEFCHVGF
DLWQVKSGTIFDNLLITDDEEYAKEFGEATWGATKEAEKKMKEQQEEEERKKTDAEDKKD
EDKKKRGRRQMLRTRKMKIRMMRTLKMRMNQRMRKRARMKPKRRRRKRTLMSMSTKSFDV
ESADGEGRR
Download sequence
Identical sequences A0A293M5H4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]