SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A293MXQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A293MXQ0
Domain Number 1 Region: 4-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-97
Family Capz beta-1 subunit 0.00000000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A293MXQ0
Sequence length 277
Comment (tr|A0A293MXQ0|A0A293MXQ0_ORNER) F-actin-capping protein subunit beta {ECO:0000313|EMBL:MAA44899.1} OX=265619 OS=Ornithodoros erraticus (European soft tick) (Alectorobius erraticus). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Argasidae; Ornithodoros.
Sequence
MTADQQLDCALDLMRRLPPQKIEKNLSDLIDLVPSLCEELLSSVDQPLKIATDKKSGKDY
LLCDYNRDGDSYRSPWSNTYDPPLEDGALPSDRLRKMEVDANQAFDQYREMYFEGGVSSV
YLWDLDHGFAGVVLIKKGGDGSRKIAGSWDSIHVVEVQEKSSGRSAHYKLTSTAMLWLQT
KKPGSGTMNLGGSLTRQMEQDSSVTDASPHIANIGKMVEDMENKIRTTLNEIYFGKTKDI
VNGLRSVQPLQDRKQQEALRNDLAQALKNRQAKQETS
Download sequence
Identical sequences A0A293MXQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]