SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A2MTL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2A2MTL7
Domain Number - Region: 88-115
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.0782
Family Bcl-2 inhibitors of programmed cell death 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A2MTL7
Sequence length 152
Comment (tr|A0A2A2MTL7|A0A2A2MTL7_9VIBR) DUF2919 domain-containing protein {ECO:0000313|EMBL:PAW03472.1} KW=Complete proteome OX=190893 OS=Vibrio coralliilyticus. GN=CKJ79_12225 OC=Vibrionaceae; Vibrio.
Sequence
MRYALEQYDKHGFLKAPKWLWLGWLFLAKAWVVFVVAGASRESGAKILNIVYPDHSMLYL
GLAMGLPSIALMWMISLRSPERKWISHLVSWGKTITMLAIGGQFVQTLYHVYLEHGAFRW
ANAATLLFLLWFMLYIYKSRSVRDCFSAPPSD
Download sequence
Identical sequences A0A2A2MTL7
WP_021457997.1.10351 WP_021457997.1.56963 WP_021457997.1.89582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]