SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A3E3L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A3E3L5
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.09e-32
Family Co-chaperone p23-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A3E3L5
Sequence length 176
Comment (tr|A0A2A3E3L5|A0A2A3E3L5_APICC) Silencing protein {ECO:0000313|EMBL:PBC25882.1} OX=94128 OS=Apis cerana cerana (Oriental honeybee). GN=APICC_02475 OC=Apoidea; Apidae; Apis.
Sequence
MTQEGQLPPPPVMWAQRKDILFVTICLEDCKDPIINIEPQMIYFKGIGGTEQKMHEITIN
LYEEITPNRTIQNLRGRTLELVLFKKEEGPYWPRLTKEKTKAHWLKSDFNKWKDEDDSDD
EGGMEGSSHDLEEMMRQMGGLGGSGDSKPNFDDLDELGDEGEGMDSDDDDLPDLLE
Download sequence
Identical sequences A0A2A3E3L5 V9IL14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]