SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2A3EJ02 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A3EJ02
Domain Number 1 Region: 138-374
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-85
Family Capz alpha-1 subunit 0.000000192
Further Details:      
 
Domain Number 2 Region: 9-70
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.42e-18
Family Capz alpha-1 subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A3EJ02
Sequence length 379
Comment (tr|A0A2A3EJ02|A0A2A3EJ02_APICC) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:PBC31668.1} OX=94128 OS=Apis cerana cerana (Oriental honeybee). GN=APICC_05446 OC=Apoidea; Apidae; Apis.
Sequence
MAADGDVIPDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLNNDNLLKEGASGAFAQYNKD
QLTPVKYSGYCLVFVVIESYTIPGKCWIKFQCLVTFLIEQHAFGISTGDIDFIVKLERDN
VHLADVIVYLKNPRIGTQQLLCENHSEIFIEIVRCNRIEGSEYPALITEHNDLGGQRFYD
ARSKQSFKYDHLRKEAQDYEPYEPDSMAEPWRSALQDEITTYTQSHYRHGACSVFGKSQG
GNITLTACIEDHQFQPKNFWNGRWRSVWTVSFSPSSGNAELRGSLKVQVHYYEDGNVQLV
SSKEVKESLPISSEKQTAKELIRLVEESENDYQTAISENYQTMSDTTFKALRRQLPVMRT
KIDWNKIVSYSIGKELKSQ
Download sequence
Identical sequences A0A2A3EJ02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]