SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A5LUJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A5LUJ8
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0000000183
Family N-terminal, cytoplasmic domain of anti-sigmaE factor RseA 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A5LUJ8
Sequence length 194
Comment (tr|A0A2A5LUJ8|A0A2A5LUJ8_9ALTE) Anti-sigma factor {ECO:0000313|EMBL:PCM43673.1} KW=Complete proteome; Reference proteome OX=2039467 OS=Marinobacter sp. ANT_B65. GN=CPA50_15005 OC=Alteromonadaceae; Marinobacter.
Sequence
MDDRLRETLSAMMDDEADELSVRRLLSHEDQAEIRDQWQRWQGIHDLMHRGQSPADGVDV
STAVRAELDGRARSQAPDKSPIHEASRRWQWPAVAMVAVALVVGFGAGAGWESGEVSPDA
LASAPAAELPGAEAVSSVAAGEDAPVQEVALQGLDEEQWEYMSRYLLEHAQHNSVGAGQG
SMGYARLVSANGSY
Download sequence
Identical sequences A0A2A5LUJ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]