SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2A6CZ04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6CZ04
Domain Number 1 Region: 486-695
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.19e-63
Family Capz beta-1 subunit 0.0000000459
Further Details:      
 
Domain Number 2 Region: 17-122
Classification Level Classification E-value
Superfamily The spindle assembly checkpoint protein mad2 0.000000248
Family The spindle assembly checkpoint protein mad2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A6CZ04
Sequence length 719
Comment (tr|A0A2A6CZ04|A0A2A6CZ04_PRIPA) Cap-2 {ECO:0000313|EMBL:PDM83358.1} KW=Complete proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=PRIPAC_34990 OC=Neodiplogasteridae; Pristionchus.
Sequence
MQMSDAQVVRFTECSSLHQMMLIVFSKILYLRKYYEDCYFFDHKIHGVTTPIIDVTNPFV
NYLIADSIKGAASAADQRYLRNVQLIFKLLNDKPERFVERYVIVFDEDNNPELMSPTGRA
SLSPVPDTHWNREDIMQMASAVDQICGDLASFPDDDPKKGGLQVMFRLDYNRNCPEGYSA
PHYTRSNYAQLKFSQLLPPVPVKRPPPQRSLSDKDKKVHSFLSVQSLLTRANSLPLPTKS
VSQQSVIRHLNATRTESSISSPYRKSRERSKESIQVPSRQKSLLPRQPAKIVLEVEDDEE
EEDLEEEEEEVGDEEDDEEEGEEDEVNDEEEEEEEPEEIETARGEDNGRKRSTDRYDEED
DRKKARSTSSSPQTNEAVERMNRAYDPNATIMSSSMDVGNDTTFPKRLSSSQSPEVLSMA
ASSPSEKEGARKKEDDDDDGEERSQEDDLNKTVQSDSGYNSALAVLPSTQSIDLSDVFRP
LARNMSDQQLDCALDLMRRLPPQQCEKNLNELIELAPSLGEDLLSTVDQPLKTAKDKETG
KEYLICDYNRDGDSYRYFDGGVSSVYFWELQDYGFAGIVLLKKIGDGTKNVKGCWDSIHV
IEIAERSRQAHYKLTSTVMLWLQTSKTGSGMMNLGGSLTRQVEQDSAVTDSTPHLVNIGR
LIEEQESKMRMTLNEIYFGKTKKVVSELRSMEKASDIRSRDVLTQEIRTAVAGRGPKDA
Download sequence
Identical sequences A0A2A6CZ04

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]