SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A7W905 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A7W905
Domain Number 1 Region: 2-189
Classification Level Classification E-value
Superfamily BB2672-like 7.32e-66
Family BB2672-like 0.0000289
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A7W905
Sequence length 192
Comment (tr|A0A2A7W905|A0A2A7W905_9BACI) Peptide synthetase {ECO:0000313|EMBL:PEJ27219.1} KW=Complete proteome OX=421767 OS=Bacillus butanolivorans. GN=CN689_24210 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLDIRKVYTAVEETRIEGGKKVENPIKMITTMAVIKNPWAGRGYVEDLMPEINEYAPQIG
ELLVAELFKHIGSADDVEAFGKAAVVGVDGEVEHASAFIHTLKFGNKFRDAVKGTSILSF
TNKRGGAGSAVIIPMVHKTDESERSHFITFEATIPDSPRADEIVVAIGASTGGRPHPRTG
NRHQDMVEMGLV
Download sequence
Identical sequences A0A2A7W905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]