SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A8E4F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A8E4F6
Domain Number 1 Region: 28-182
Classification Level Classification E-value
Superfamily TIMP-like 2.51e-29
Family Tissue inhibitor of metalloproteinases, TIMP 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A8E4F6
Sequence length 184
Comment (tr|A0A2A8E4F6|A0A2A8E4F6_BACCE) Cobalamin biosynthesis protein CbiN {ECO:0000313|EMBL:PEN89367.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=CN553_22710 OC=Bacillus cereus group.
Sequence
MKRILHMFPVVIICSFILIIFPEKSYACDCIKVSTEDAFQKNDVVFEGKVIEVGRKEGVG
TEVLFEVKKIWKGTTSSQIIVYTKGGDCMFRFVEGGEYLVFSTQRGSEKQLYTNSCSGTK
RLDEAGADKAALSQIAKESVPTKKVDLKGEMVSGLNWRQVAIISIGLLLMIVFVIFIVRK
TRKK
Download sequence
Identical sequences A0A2A8E4F6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]