SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2A9NQN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A2A9NQN0
Domain Number - Region: 160-207
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.000314
Family Capz alpha-1 subunit 0.058
Further Details:      
 
Domain Number - Region: 101-327
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00296
Family Protein kinases, catalytic subunit 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A9NQN0
Sequence length 429
Comment (tr|A0A2A9NQN0|A0A2A9NQN0_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:PFH49992.1} OX=703135 OS=Amanita thiersii Skay4041. GN=AMATHDRAFT_86072 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MSKDKPDELNRVVHYPEISTTDWQFWESKRSWFEKHAYTLYKVEYVHVEALGIMDPVNRY
STRRESVVGRFPFAPCSGSIIDGVLRTVFVYPLIPFIHNMNMVYVQPHIAFAQDSQNRHV
AIKLVVAGTQEANILEYLTEASSEIDINSFQGVIPVLEVLHYDEDYLFFVMPRVEHALDF
VYCMLKVCINNSNCTRGYWRSQLLVNYIWNDFFRDENDMKFHQHMHSQNMIRYAIFDFNL
GVKLPDSVDPSTFRLPIEFASEGPWCEPFDRAHGVLDYRPFAYDVACMGILIYQELGDII
TFAPLLAPLIDMMVTPDIDKRFAAQQEFFSKLKSEMEEEELKRTISTDIPEVTTPWRDFQ
RCNGLSNEFIQKWSAYRVPPPSVPRRILRAFCGHAWGWNTVHCIRRIFQTIRRFIFFWGP
SRVPLSLPV
Download sequence
Identical sequences A0A2A9NQN0
jgi|Amath1|86072|estExt_fgenesh1_pg.C_460012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]