SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A9NRV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A9NRV0
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-41
Family Calponin-homology domain, CH-domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 169-236
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 8.76e-19
Family EB1 dimerisation domain-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A9NRV0
Sequence length 252
Comment (tr|A0A2A9NRV0|A0A2A9NRV0_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:PFH53269.1} OX=703135 OS=Amanita thiersii Skay4041. GN=AMATHDRAFT_55014 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MAGRSDLLSWLNDLLAINYTKIEQCGTGAAYCQVLDSVYGDIPMNRVKFNAKHEYEFIAN
FKVMQNVFKAKKIDKPIPVEKLVKCKMQDNLEFLQWMKRFWDQNYGGQGYDAAARRKGAP
ADPPATIAPLSTGRSSSSSNNLAVGASARSGGKTPVGHRAGSAQPTEAVQQLQAQLKEMS
THLEGLEKERDFYFSKLRDIEILVQTQLEVLEAEGKEDETLKKIQEILYSTEEGFEVPEA
NTTAPVDEEETF
Download sequence
Identical sequences A0A2A9NRV0
jgi|Amath1|55014|fgenesh1_kg.6_#_138_#_isotig14767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]