SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A2B7Y2W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2B7Y2W7
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-85
Family Capz alpha-1 subunit 0.00000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2B7Y2W7
Sequence length 275
Comment (tr|A0A2B7Y2W7|A0A2B7Y2W7_9EURO) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:PGH15037.1} KW=Complete proteome; Reference proteome OX=1447875 OS=Helicocarpus griseus UAMH5409. GN=AJ79_02719 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Helicocarpus.
Sequence
MSSNLEIASSFIQGAPPGELSDVVADIKALTPEGPGLISSLAPAFEKYNEEQLATVKLPG
SSEEVIVSAFNKLEDGRYFDVQSQTSFAFDHVNQEASSPQSYVLESQNSDFIKSLLKSLS
SHAKEHYPNCSFGVYPIEDDTAAAIVLVANKYSPNNFWNGRYRSIYTVPLPSADAVTGTI
HINVHYYEDGNVSLNTKKPVSISLSPNSSADAVIKRIAAAERAQQLELSDAFSRLSEGAF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGAKGR
Download sequence
Identical sequences A0A2B7Y2W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]